General Information

  • ID:  hor005293
  • Uniprot ID:  P41337
  • Protein name:  Pancreatic hormone
  • Gene name:  PPY
  • Organism:  Larus argentatus (Herring gull)
  • Family:  NPY family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Larus (genus), Laridae (family), Charadriiformes (order), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  GPVQPTYPGDDAPVEDLVRFYNDLQQYLNVVTRHRY
  • Length:  36
  • Propeptide:  GPVQPTYPGDDAPVEDLVRFYNDLQQYLNVVTRHRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P41337-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P41337-F1.pdbhor005293_AF2.pdbhor005293_ESM.pdb

Physical Information

Mass: 486114 Formula: C191H284N52O58
Absent amino acids: CIKMSW Common amino acids: V
pI: 4.59 Basic residues: 4
Polar residues: 10 Hydrophobic residues: 10
Hydrophobicity: -79.17 Boman Index: -8508
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 75.56
Instability Index: 6216.39 Extinction Coefficient cystines: 5960
Absorbance 280nm: 170.29

Literature

  • PubMed ID:  8174930
  • Title:  Isolation and structural characterisation of herring gull (Larus argentatus) pancreatic polypeptide.